SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345659 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345659
Domain Number 1 Region: 16-265
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-99
Family Carbonic anhydrase 0.0000000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345659
Sequence length 267
Comment CA7 (Homo_sapiens) carbonic anhydrase VII
Sequence
MEPLGGRWWVPVGVRAGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACT
SLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKRDVGSEHTVDGKSFP
SELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTRAQ
FSCFNPKCLLPASRHYWTYPGSLTTPPLNESVTWIVLCEPISISERQMEKFRSLLFTSED
DERIHMVNNFRPPQPLKGRVVKASFRA
Download sequence
Identical sequences G5BDH3
HGL_H00000345659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]