SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345767 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345767
Domain Number 1 Region: 14-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-68
Family Ankyrin repeat 0.0000652
Further Details:      
 
Weak hits

Sequence:  HGL_H00000345767
Domain Number - Region: 415-515
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0693
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345767
Sequence length 723
Comment ANKRD6 (Homo_sapiens) ankyrin repeat domain 6
Sequence
MSQQDVVAALSERLLIAAYKGQAENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIQEGCALDRQDKDGNTALHEASWHGF
SQSAKLLVKAGANVLARNKAGNTALHLACQNNHSQSTRILLLGGSRADLKNNVGDTCLHV
AARYNHLSIIRLLLSAFCSVHEKNQAGDTALHVAAALNHKKVVKILLEAGADGTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKRRERLKEERRAQSVPREEVAQSKG
SVSAGDTPSSEQAGVKKEEAREDFLSASPEPRAKDNRRRKSRPKVSALSDLTPPANQQPG
PQKDSHAHHHPKRKSRHRCLSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGHMENKTQHQIRVLDKLMVERLSAERTECLNRL
QQHSDAEKHEGEKRQMSLVDELKTWCMVKIQNLELKLTGDSRTSRAKSTPSTCDSSTGVD
QSVVTAGPAAASDSSSQVVRPKEKAPNMTATHRLQQELSSSDCTGSRLRNVKVQTAQLPL
NEAAKCDQQAGPCVNRGTQTKKSGKSGQTRHRAQQPSGTCGRSAAGNEQAAPHVRDTSQA
LELTQCFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLRTKVQ
KEN
Download sequence
Identical sequences G5C8Z9
HGL_H00000345767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]