SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345808-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345808-2
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000387
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 183-245
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000124
Family BCR-homology GTPase activation domain (BH-domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345808-2
Sequence length 250
Comment ARHGAP12 (Homo_sapiens) Rho GTPase activating protein 12
Sequence
MKMADRSGKAVPGQVYTEVEYDYEYKAKDRKVVIKQGEWYILVKKTNEDWWKVKSDENSK
VFYVLAQYVKKFTCRALMPPVKQATRLPNNSMETIQSLHLQRYTENVNKLPELLSFGKPS
PSVQGTGLIHYANQNFGHCYYPCQILTLSLDVTHNNGKFNNDSHSPKVSSQNRTHLFGHF
ADQVFGANLVNWCQRENSTVPEFVRLCIAHVEEQGLDGDGFYGVSGNLTVIQKLRFVVNH
DEKLDLNDSK
Download sequence
Identical sequences G5BHE0
HGL_H00000345808-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]