SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346120 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346120
Domain Number 1 Region: 255-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-67
Family Tandem AAA-ATPase domain 0.0003
Further Details:      
 
Domain Number 2 Region: 619-701
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.72e-25
Family GUCT domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346120
Sequence length 777
Comment DDX21 (Homo_sapiens) DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Sequence
MPGKLRSNAGLESDMAMEKKGNEKKGRKEKPKSNKTEESEGKEETVSSKAKNVKKKVGPS
EVDVNPSESKKAKKQDEPPQDEVVSPKTKSTKKQKEPLEKKVVSPKTKKVIKNEEPSEED
IGAPKPKKMKKEKEVNGEIGEKSPKLKNGFSHPKADSSDAASEESNSEIEQEIPVEQKEG
AFSNFPISEETVKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIE
KLQGQLQDRKRGRAPQVLVLAPTRELANQVSRDFSDITKKLAVACFYGGTPYGGQIERMR
NGIDILVGTPGRIKDHLQNGKLDLSKLKHVVLDEVDQMLDMGFAEQVEDILCVAYKKDSE
DNPQTLLFSATCPSWVFNVAKKYMKSIYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAV
IGDVIRVYSGHQGRTIVFCETKKEAQELSQNASIKQDAQSLHGDIPQKQREITLKGFRNG
DFGVMVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEE
YQLAQVEQKAGIKFKRIGVPSPTEIIKASSKDAIRLLDSVPPTAIGHFKQSAEKLIEEKG
AVEALAAALAHISGATSVDQRSLINSEAGFVTMILRCSVEMPNISYAWKELKEQLGEDID
SKVKGMVFLKGKLGVCFDVRTAAVTEIQEKWHDSRRWQLAVATEQPELEGSREGFRGSRG
REGGRGFRGQRDGSRGFRGQRGGGNRNFRGQRSGGGNKSNRSQNTGQKRSFSKAFGQ
Download sequence
Identical sequences G5B803
HGL_H00000346120 XP_004846232.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]