SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346291 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346291
Domain Number 1 Region: 375-977,1020-1059,1089-1247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-197
Family Motor proteins 0.0000000303
Further Details:      
 
Domain Number 2 Region: 211-311
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000453
Family PDZ domain 0.0076
Further Details:      
 
Domain Number 3 Region: 1448-1565
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000471
Family Myosin rod fragments 0.008
Further Details:      
 
Weak hits

Sequence:  HGL_H00000346291
Domain Number - Region: 1722-1816
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00118
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number - Region: 1251-1347
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00628
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 1379-1475
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.0026
Further Details:      
 
Domain Number - Region: 1770-1972
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346291
Sequence length 2057
Comment MYO18A (Homo_sapiens) myosin XVIIIA
Sequence
MFNLIKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL
EISNPIPIKVASGSDLHLTDIDSDSNRGSIILDSGHLSTASSSDDLKGEEGSFRGSVLQR
AAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLMQHP
GSGIPRSGARSRVPELLTKRFPADLRLPPVVPPPPPAPRELELQRRPTGDFGFSLRRTTM
LDRGPEGQAYRRVVHFAEPGAGTKDLALGLVPGDRLVEINRHNVEGKSRDEIVEMIRQSG
DSVWLKVQPIPELSELSRSWLRSGEGHRREPADAKTEEQLAAEEAWYETEKVWLVHKDGF
SLASQLKSEELSLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNEPS
VLHTLRQRYGASLLHTYAGPSLLVLSPRGAPSVYSEKVMHMFKGCRREDMAPHIYAVAQT
AYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGTSGNKVFSAEKWQALYTLLE
AFGNSPTIMNGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNIFYY
LLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQTAMKVLGISPDEQK
ACWLILAAIYHLGAAGATKDTFFCFTAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQ
HKGGTLQRSTSFRQGPEESSLGDGTGPKLSALECLEGMASGLYSELFTLLISLVNRALKS
SQHSLCSMMIVDTPGFQNPEQGGSSRGASFEELCHNYTQDRLQKLFHERTFVQELERYKE
ENIELAIDDLESATDDSVAAVDQASHQSLVRSLARADEARGLLWLLEEEALVPGATEDTL
LERLFSYYGPCEGDKKGQSPLLRSSKPHHFLLGHSHSTNWVEYNVAGWLSYTKQNPATQN
APRLLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVK
KKSLCIQIKLQVDALIDTIKRSKMHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPQG
DPCEAGLLQLDVPLLRAQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHG
RNYIVVDEKRVVEELLESLDLEKSSWCMGLSRVFFRAGTLARLEEQRDEQTSRHLTLFQA
ACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIR
NKDEEIQQLRNKLEKVEKERNELRLNSDRLETRISELTSELTDERNTGESASQLLDAETA
ERLRAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYER
AMREVDFTKKRLQQELEDKLEAEQQSKRQLERRIGDMQADSDESQRALQQLKKKCQRLTA
ELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFS
LKQQMEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEE
LDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMENRDEEVEEARQSCQKKLKQMEVQLEE
EYEDKQKALREKRELESKLATLSDQVRQRDFESEKRLRKDLKRTKALLADAQIMLDHLKN
NAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTVLEEQLSRL
QREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQMNDLQAQLEEANKEKQELQEKL
QALQSQMEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLANRLKENMEKLTE
ERDQHTAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQS
LQADLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELE
DRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSHWKSPPPGQSDDEHDPLDSTSRPRYSH
NYLSDNDTEAKLLETDA
Download sequence
Identical sequences G5BVJ4
HGL_H00000346291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]