SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346300 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346300
Domain Number 1 Region: 12-104,152-178
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-28
Family SH2 domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 106-198
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-23
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 3 Region: 227-300
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000578
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346300
Sequence length 303
Comment CRKL (Homo_sapiens) v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPIGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSNTPGATINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
Download sequence
Identical sequences G5C031
XP_004874960.1.39548 HGL_H00000346300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]