SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346401-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346401-2
Domain Number 1 Region: 186-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-52
Family Motor proteins 0.000017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000346401-2
Domain Number - Region: 78-193
Classification Level Classification E-value
Superfamily Tropomyosin 0.000235
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346401-2
Sequence length 405
Comment KIF25 (Homo_sapiens) kinesin family member 25
Sequence
MVAAQRFPRKTGPFPPAPGNSCCRVEGGGVGDAGAVISCQRLDSLAPKNQKPVPTVPAQK
PAAGGKKPGKRPAWDLKGQLCDVRAELQCCREKTQTLDRENQQLRDQLQEAQQQAQALGA
ERCSLEGELARVQAQAEQGQRELGSLRARVLELEERLGMQEGLVHMLQREQLELQEERRT
LATRLEEQEVRALLRLAHQNRAVARTAYNERSSRSHSVFQLQISGEHAARGLQCGAPLNL
VDLAGSERLDPSLALGPGERDRLRETQAINSSLSTLGLVIMALSNKEPHVPYRNSKLTYL
LQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVRFPPHPGPVETPVVRGISIPAPL
SSTGGTFIQKGLHPPGIWHCVCGTGHGPELHTLSYTPPPRPFLYF
Download sequence
Identical sequences G5BK18
HGL_H00000346401-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]