SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346534 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346534
Domain Number 1 Region: 1194-1349,1392-1468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1518-1766
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.75e-40
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 3 Region: 750-897,931-978
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.69e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 131-276,349-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.39e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000346534
Domain Number - Region: 1773-1820
Classification Level Classification E-value
Superfamily EF-hand 0.0126
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346534
Sequence length 1976
Comment SCN8A (Homo_sapiens) sodium channel, voltage gated, type VIII, alpha subunit
Sequence
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNL
IRRIAIKILIHSLFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESVVKILAR
GFCIDGFTFLRDPWNWLDFSVIMMAYITEFVNLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGF
DWEEYINNKTNFYTVSGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAF
LALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGVGSPRSSSEI
SKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKF
SIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDS
LFIPIRARERRSSYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGSHIGGRL
LPEGTTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPCW
YKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEH
VLTVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSVL
RSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKE
CVCKINQNCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVI
GNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHF
KQHEGDEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDH
MSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEV
EEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETF
IIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNA
WCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGA
IPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHFCFNETSEIRFEIEHVNNKTECEKLMEGN
NTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYMYIY
FVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPI
PRPLNKIQGIIFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIF
FTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARI
GRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDD
MFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIF
FFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIE
YCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDI
LRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFSCKKMTSNK
LENGGTHQEKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRKERAKRQKEVRESKC
Download sequence
Identical sequences G5ATY2
HGL_H00000346534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]