SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346591 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346591
Domain Number 1 Region: 197-274
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.39e-18
Family Middle domain of MutM-like DNA repair proteins 0.0058
Further Details:      
 
Weak hits

Sequence:  HGL_H00000346591
Domain Number - Region: 130-182
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0445
Family N-terminal domain of MutM-like DNA repair proteins 0.015
Further Details:      
 
Domain Number - Region: 2-59
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0589
Family N-terminal domain of MutM-like DNA repair proteins 0.0093
Further Details:      
 
Domain Number - Region: 277-322
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0599
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346591
Sequence length 334
Comment NEIL2 (Homo_sapiens) nei endonuclease VIII-like 2 (E. coli)
Sequence
MPEGPSVRKFHHLVSAFMGQQVVRTGGSSKKLCPASLQSLWLQDTQVHGKKLFLRFDADV
DTDEEVGAPGSSPRPEPLQKRARREATVGPAPEPNAQNTCDGSSLSAGLLPRGPGGPDGL
VGDSLTAGAPRWLQVHFGLFGSVWVNDFSRAKKPNKRGDWRDPMPRLVLHFGGGGFLAFY
SCQMSWSLAPAIEPCRDILSEEFHRGQALEALGRPQPVCYTLLDQRYFSGLGNIIKNEAL
YKARIHPLSLGSLLSASCLETLVEHVVEFSTDWLRGKFQGQQRRTQVYQKEQCPAGHQVL
KEAFGPPGGLQRLTWWCPQCQPRLPPEEPQQLQS
Download sequence
Identical sequences G5AMF5
XP_004848515.1.39548 HGL_H00000346591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]