SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346601 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346601
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.19e-43
Family Voltage-gated potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346601
Sequence length 778
Comment KCNQ2 (Homo_sapiens) potassium voltage-gated channel, KQT-like subfamily, member 2
Sequence
FLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRG
RLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWK
LLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIG
YGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGL
IQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
QPEPSPSQKVSLKDRVFSSPRGVAAKGKGSPQAQPVRRSPSAEQSLEDSPSKVPKSWSFG
DRSRARQAFRIKGATSRQNSEEASLPGEDIVEDNKSCNCEFVSEDLTPGLKVSIRAVCVM
RFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQIDMIVGPPPPSTPRHKKYPT
KGPTAPPRESPQYSPRVDQIVGRGPAITDKDRTKGPAEAELPEDPSMMGRLGKVEKQVLS
MEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDKHGCIIKIVRS
TSSTGQRNFSAPPTVPPAQCPPSTSWQQQGQQRHGTSPVGDHSSLVRIPPPPAHERSLSA
YSGANRASTEFLRLEDTPACRPHEGIPRDSDTSISIPSVDHEELERSFSGFSISQSKENL
DALSGCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSATGEGPFGDMGWAGPRK
Download sequence
Identical sequences G5C8D4
HGL_H00000346601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]