SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346733 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346733
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-78
Family BAR domain 0.00081
Further Details:      
 
Domain Number 2 Region: 389-505
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.1e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00025
Further Details:      
 
Domain Number 3 Region: 248-352
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-27
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 4 Region: 656-772
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-24
Family Ankyrin repeat 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346733
Sequence length 818
Comment ACAP3 (Homo_sapiens) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Sequence
RATIDEVETDVVEIETKLDKLVRLCSGMIEAGKAYVTTNRLFVSGVRDLSQQCQGDTVIS
ECLQRFGDSLQEMVNFHTILFDQAQRSVRQQLHNFIKEDVRKFKETKKQFDKVREDMELS
LVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFMH
AQYSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKHAAIQQRTLLQDFSYD
ESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDSLTVVVDDL
RLCSVKPCEDTERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYS
ERLDRTASPSTSSIDSTTDSRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGV
LLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTINQIYEFQCEGPSSRKP
TASSPRQDKEAWIKDKYVEKKFLGKLPTVPTLEAPRHWRGQKCQRPHSSPRPPPTRRKAR
LEPVLPSLAALSSAGTLERRFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGGS
SDGSSDVLAFGAGSVVDSVTEEEGAESEESSGEADGEAEAWSLADVRELHPGLLAHRAAR
TRDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIICEFLLQNGADVNQRDSRGR
APLHHATLLGRTGQVCLFLKRGADQHALDEQQQDPLSIAVQAANADIVTLLRLARMAEEM
REAEAPSGQPGPLAGISPTELQYRRCIQEFIGLHLEES
Download sequence
Identical sequences G5ATQ7
HGL_H00000346733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]