SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346827 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346827
Domain Number 1 Region: 30-514
Classification Level Classification E-value
Superfamily ALDH-like 1.3e-167
Family ALDH-like 0.00000000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346827
Sequence length 518
Comment ALDH9A1 (Homo_sapiens) aldehyde dehydrogenase 9 family, member A1
Sequence
MWLAAPAAAPSSLLRAPWLALAAAMSTGTFSLSQPLNYRGGARVEPADASATEQAFEPAT
GRVVATFACSGEKEVNLAVQNAKAAFKIWSKKSGMERCRILLEAARIIREQKDAIATMET
INNGKSIFEARWDIDTSWQCLEYFAGLAGSMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMVFKPSPFTPISAVLLAEVYTLAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGVKIMELSAKGVKPVTLELGGKSPLIIFSDCNMENAVKGA
LMANFLTQGQVCCNGTRVFVQKEILGKFTEEVVKQTQKIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKLAKEQGAKVLCGGDLYVPEDPKLKDGYYMRPCILTNCRDDMTCVKEEIFGPV
MSILPFDTEAEVLERANNSTFGLAAGVFTRDIQRAHRVVAELQAGTCYINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESTF
Download sequence
Identical sequences G5AQ32
XP_004865244.1.39548 HGL_H00000346827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]