SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346839 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346839
Domain Number 1 Region: 1540-1715
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-29
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 2 Region: 908-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 7.11e-26
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 3 Region: 1906-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-25
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 4 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-22
Family Fibronectin type III 0.00000983
Further Details:      
 
Domain Number 5 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 7.55e-22
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-20
Family Fibronectin type II module 0.000064
Further Details:      
 
Domain Number 8 Region: 1725-1894
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 9 Region: 1448-1537
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-19
Family Fibronectin type III 0.00000425
Further Details:      
 
Domain Number 10 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 1.98e-16
Family Fibronectin type III 0.00000324
Further Details:      
 
Domain Number 11 Region: 2340-2383
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 13 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000432
Family Fibronectin type I module 0.0021
Further Details:      
 
Domain Number 14 Region: 619-698
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000552
Family Fibronectin type III 0.00000713
Further Details:      
 
Domain Number 15 Region: 230-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000127
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 473-512
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000288
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 2295-2338
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000014
Family Fibronectin type I module 0.0042
Further Details:      
 
Domain Number 20 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000055
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2383-2424
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0025
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000262
Family Fibronectin type I module 0.00034
Further Details:      
 
Domain Number 24 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000187
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 25 Region: 2209-2272
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000193
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346839
Sequence length 2477
Comment FN1 (Homo_sapiens) fibronectin 1
Sequence
MLRGPGPGLLLLAALCLGTAVLSTGASKSKRQAQQIVQPQSPVTVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGDQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHASLQAASTGSGGPFTDIRAAVYQPQPQ
PQPVPYGHCVTDSGMVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRTFYSCTSEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHRVRYQCYCYGRGIGEWHC
QPLQTYAGTSGPVQVIITETPSQPNSHPIQWNAPEPSHITQYVLRWRPKNTAGHWKEATI
PGHLNSYTIKGLTPGVVYEGQLISYQQYGQREVTRFDFTTSASTPVTSNTVTGETTPLSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPNPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETADSVTLSDLQPGIQYNITIYAVEENQESTPVFIQQETTG
VPRSDKVSPPRDLQFVEVTDVKVTIMWTPPDSAVTGYRVEVLPVNLPGEHGQRLPVNRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAQQMTKLDAPTNLQFTNETDTTVLVIWIPP
RAKITGYRLIVGLTRGGQPKQYNVGPSASKYPLRNLQPGSEYSVSLVAIKGNQQSPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYIYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEVNPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCIFENLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIELTNFVLRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTDYLISVSSVYEQHESIP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRASITGYKIRHHPEHLSGRPREDRVPPS
RNSITLTNLNPGTEYVVSIVAVNGREESPVLIGQQSTISDVPRDLTVIASSPTSVMIQWD
APGVTVRYYRITYGETGGSSPVQEFTVPGTKTMATISNLKPGADYTITLHAVTGRGDSPA
SSKPISIDYQTEIDKPSQMQVTDVQDNSISVRWLPSNSPVTGYKVTTTPKNGSGPSKTET
VGPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESKPLIGTQSTAIPAPTNLKFTQVTPTSLSAQWTAPNVQLTGYRVRVTPKEKTGPMKEIN
LSPDSSSVVVSGLMVATNYEVSIYALKDTLTSRPAQGVVSTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAIPATGQTPVQRTISPDIRSYTITGLQPGTDYKIHLYTLNNN
ARSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATIIGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVHKTPFITNSGDHTGNGIQLPGTSPQQPTVGQQMIFEEHGFRRTTPPTAATPV
RHRPRPYTPNVDEEMEIGHVPRGDVDHYLYPHVLGLNPNASTGQEALSQTTISWTPFQES
SEYIISCHPVGIDEDLLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQRRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAIGEEWERLSEAGFKLTCQCLGFGSGHFRCDSSK
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKIYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGPEGSTGHSYNQYTQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
Download sequence
Identical sequences G5BHR4
HGL_H00000346839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]