SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347019 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347019
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 651-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 692-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347019
Sequence length 752
Comment ZNF350 (Homo_sapiens) zinc finger protein 615
Sequence
LLFQESLTLEDVAVRFTREEWQLLGPAQKDLYRDVMLENYSSLVSVGYQASQPDSLSSLL
CGEPWMVEDELHCGTHSDLTLVNQSKSCEIKNPMAFPRREESFFPANCEKLHTEILFPAS
QKHISIKSQFSSRKPKKTQKVEKRHVCSECGKAFVKKSWLTDHEIIHTGEKPHRCGLCGK
AFSRKFMLTEHHRTHTGEKPYACTECGKAFLKKSRLSIHQKTHTGEKQYICSECGKSFIQ
KGNLIVHQRIHTGEKPYICSECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQRSGL
IKHQRIHTGEKPFVCSDCGKAFTTKQKLIVHQRTHTGEKPYGCNDCGKAFAYMSCLVKHK
KIHTREKQRHTMRSEKPAESDSSLYIGGVIQETNPVSTVITQVPSVASQSALNISGLANR
NVVLMGQPVARWYQASQPDSLSSLLCGEPWMVEDELHCGTHSDLTLVNQSKSCEIKNPMA
FPRREESFFPANCEKLHTEILFPASQKHISIKSQFSSCKPKKTQKVEKRHVCSECGKAFV
KKSWLTDHEIIHTGEKPHRCGLCGKAFSRKFMLTEHHRTHTGEKPYACTECGKAFLKKSR
LSIHQKTHTGEKQYICSECGKSFIQKGNLIVHQRIHTGEKPYICSECGKGFIQKTCLIAH
QRFHTGKTPFVCSECGKSCSQRSGLIKHQRIHTGEKPFVCSDCGKAFTTKQKLIVHQRTH
TGEKPYGCNDCGKAFAYMSCLVKHKKIHTREK
Download sequence
Identical sequences G5B3C6
HGL_H00000347019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]