SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347198 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347198
Domain Number 1 Region: 9-171,198-322
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.46e-63
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 485-679
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000643
Further Details:      
 
Domain Number 3 Region: 728-790
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347198
Sequence length 1070
Comment SRGAP1 (Homo_sapiens) SLIT-ROBO Rho GTPase activating protein 1
Sequence
MHSLLSLEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFM
AKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISED
STRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGR
SGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVF
KYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDK
QRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQQLQSRLATLKIENEE
VKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLSKPSIAKRRANQQET
EQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHKAEYMTTRPPNVPPKPQKHRKSRP
RSQYNAKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKN
SFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERALH
IRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQVSC
QAHVNEIVKTIIIHHETIFPDSKELDGPVYEKCMAGDDYCDSPYSEHGTLEEVDQETGTE
PHTSEDECEPIEAIAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQ
YIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHSDGYLARQRKRGEPP
PPLRRPGRTSDGHCPLHPPHALSNSSVDLGSPNLAGQPRGLLQNRGLNNDSPERRRRPGH
GSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQDIEETMNTALNELRE
LERQSTAKHAPDVVLDTLEQVKNSPTPAISTESLSPLHNVALRSSEPQIRRSTSSSSDTM
STFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTVGPAPPSQGPADKSCTM
Download sequence
Identical sequences G5ALG1
HGL_H00000347198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]