SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347234 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347234
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-23
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 360-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000383
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347234
Sequence length 496
Comment ZNF565 (Homo_sapiens) zinc finger protein 565
Sequence
QGLITFRDVAIEFSQEEWKYLEPSQRDLYKDVTLENFSHLVTLGLSISKPDVISLLEQGK
EPWMVTNDMTGPWYQGLESRCKTFPQKDIFEIKSFHWEVMESLKNCDLDGSSFRGDWECK
GQFERQVNQECYFKQVEITYENMPSFEHHRSLTPHQHSRTSEKMIECSECGKVFHRGSHL
SQHQKTHTGEKPFECKGCGKAFSRASHLVQHQRIHTGEKPYGCKECGKAFGRTSELILHQ
RLHTGVKPYECKECGKTFRQHSQLILHQRTHTGEKPYVCKDCGKAFIRGSQLTVHRRIHT
GARPYQCKECGKAFRQHSQLTVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGEKP
YECKECGKAFRQHAQLTRHQRVHTGDRPYECKDCRKAFSRSSYLIQHQRIHTGDKPYECK
ECGKAFIRVSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECGQ
AFVLGSQLIEHYRIHT
Download sequence
Identical sequences G5BK06
HGL_H00000347234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]