SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347464 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347464
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.84e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.03e-19
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347464
Sequence length 813
Comment GIT2 (Homo_sapiens) G protein-coupled receptor kinase interacting ArfGAP 2
Sequence
MSKRLRSSDVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPTKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSGGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKRKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQASGSGRQKLARFNAHEFATLVIDILSDAKRR
QQGSPLSSSKDSVELILKTVNSQHSTESQDNDQPDYDSVASDEDTDLETTASKANRQKSL
DSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKSLDSDLSDGPVT
VQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSSLRKQATTNIYQV
QTGSEYPETSSHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEANHPEESRTRLQPFPA
HIGRSALVTSSSSLPSFPSTLCWSRDETTRRASRLEKQNSTPESDYDNTPNDMEPDDMGS
GRKGRQRSMVWPADSSVPDATEPHTSPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKH
DSYIPCSERIHVAVTEMAALFPKKPKSDTVRTSLRLLTSSAYRLQSECKKALPGDPGSPT
DVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences G5B651
HGL_H00000347464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]