SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347507-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347507-1
Domain Number 1 Region: 2304-3018
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-250
Family Motor proteins 0.00000000000000132
Further Details:      
 
Domain Number 2 Region: 56-645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-214
Family Motor proteins 0.0000000000000388
Further Details:      
 
Domain Number 3 Region: 645-1016
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-132
Family Motor proteins 0.0000000000257
Further Details:      
 
Domain Number 4 Region: 3019-3143
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.07e-26
Family Myosin rod fragments 0.000000595
Further Details:      
 
Domain Number 5 Region: 3415-3531
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.03e-25
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number 6 Region: 3137-3251
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.09e-24
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1014-1136
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.76e-24
Family Myosin rod fragments 0.000000642
Further Details:      
 
Domain Number 8 Region: 1129-1230
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.07e-20
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 9 Region: 1440-1533
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.49e-19
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number 10 Region: 1539-1606
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000000186
Family Myosin rod fragments 0.0083
Further Details:      
 
Domain Number 11 Region: 3610-3732
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000105
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number 12 Region: 1685-1807
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000022
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number 13 Region: 2226-2260
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00000000726
Family Myosin S1 fragment, N-terminal domain 0.0024
Further Details:      
 
Domain Number 14 Region: 1237-1277
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number 15 Region: 3763-4018
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000948
Family Tropomyosin 0.00057
Further Details:      
 
Weak hits

Sequence:  HGL_H00000347507-1
Domain Number - Region: 1884-2000
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000154
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 1988-2185
Classification Level Classification E-value
Superfamily Tropomyosin 0.00049
Family Tropomyosin 0.00075
Further Details:      
 
Domain Number - Region: 1274-1387
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000968
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number - Region: 3987-4092
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0119
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number - Region: 3250-3363
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0126
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 1607-1689
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 1810-1915
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347507-1
Sequence length 4163
Comment MYH7 (Homo_sapiens) myosin, heavy chain 7, cardiac muscle, beta
Sequence
MGDAEMSAFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKAKIVSREGGKVT
AETEHGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYASSAS
LSSLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVN
TKRVIQYFAVIAAIGDRSKKDQNPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKF
IRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNP
YDYAFISQGETTVASIDDSEELMATDNAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQK
QREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVAYATGAL
AKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQ
FFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMT
FKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLQKNKDPLNETVVG
LYQKSSLKLLSNLFANYAGADAPVDKGKGKAKKGSSFQTVSALHRFNSFEQLCINFTNEK
LQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKAT
DMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLQKNKDPLNET
VVGLYQKSSLKLLSNLFANYAGADAPVDKGKGKAKKGSSFQTVSALHRENLNKLMTNLRS
THPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRI
LNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRI
ITRIQAQSRGVLSRMEYKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAE
TEKEMATMKEEFGRIKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEER
CDQLIKNKIQLEAKVKEMNERLEDEEEMNATAKKRKLEDECSELKRDIDDLELTLAKVEK
EKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVK
LEQQVDDLEGSLEQEKKVRMDLERAKRKLEALAGPSLHQLEGSLEQEKKVRMDLERAKRK
LEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQAR
IEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKM
RRDLEEATLQHEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSN
MEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEK
EALISQLTRGKLTYTQQLEDLKRQLEEEVKKSSAAVPGRQGELSRQLDEKEALISQLTRG
KLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKA
NSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNE
IEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKL
KNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKSIHELEKIRKQLEAEKLELQSAL
EEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAE
TRSRNEALRVKKKMEGDLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRAN
DDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLI
NQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK
NMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSE
RRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELD
EAEERADIAESQVNKLRAKSRDIGTKPQKSHTMADSQMADFGEAAPYLRKTEKERLEAQT
RPFDIRTECFVPDDKEEFVKAKIVSREGGKVTAETENGKGLMRSGHGKLTGADQTTPTLT
DEECRAKALTPQSTATGGGFKVRTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYN
LKERYAAWMIYVNLLRPLLRHCQPLHLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQY
MLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNPNANKVPWGPQGTLE
DQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQL
KAERNYHIFYQILSNKKPELLDMLLLTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFD
VLGFTQEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLK
GLCHPRVKVGNDFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQAC
IDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLI
HYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLKLMATLFSSYASADTGDSGKAKGGKK
KGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVL
EGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFG
HTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGQLMRIEFKKIVERRDALLIIQWNIR
AFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRIKEALEKSEARRKELEEKMVS
LLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMKAELTAK
KRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKAL
QEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDL
KLTQESIMDLENDKQQLEEKLKKKEFDINQQNSKIEDEQALALQLQKKLKENQARIEELE
EELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLE
EATLQHEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQII
KAKANLEKVSRTLEDQANEYRMKLDEAQRTLNDFTTQRAKMQTENGELTRQLEEKEALIS
QLTRGKLSYNQQLEDVKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQR
VLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEDQAH
RLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESKSELESSQKEARSLST
ELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLE
LQAALEEAEASLEHEEGKILRAQLEFSQVKAEIERKLAEKDEEMEQAKRNHLRVVDSLQT
SLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRTASEGQKHLKIAQAHLKDTQIQLDD
AVRANDDLKENIAIVERRNTLLLAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQ
NTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHL
ERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKG
MRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKV
QHELDEAEERADIAESQVNKLRAKSRDIGTKTFILEQDGWWPKRTVAPATISKLRGPKHP
TSTEEETKPRQGVLPNSTSPSPA
Download sequence
Identical sequences G5ASL9
HGL_H00000347507-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]