SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347538 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347538
Domain Number 1 Region: 366-503
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.77e-32
Family Synaptotagmin-like (S variant) 0.00021
Further Details:      
 
Domain Number 2 Region: 226-362
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.77e-31
Family Synaptotagmin-like (S variant) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347538
Sequence length 518
Comment SYT17 (Homo_sapiens) synaptotagmin XVII
Sequence
MLAVETEFPNVFVSLRTGLLVIWGVVSPLPPLPPLHPPCLPPSTRSPDPLPAWPQGFLSR
ISDLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLIASRSGDKDGDSVHT
ASDVPLTPRTSSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDIKPIEFGILSAKK
EPIQPSVLRRTYTPDDYFRKFEPQLYSLDSSSDDVDSLTDEEILSKYQLGMLHFSTQYDL
LHNHLTVRVIEARDLPPPIAQDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVF
EERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSS
QNEVELGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKK
TSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSE
SNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
Download sequence
Identical sequences G5AY28
HGL_H00000347538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]