SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347710 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347710
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347710
Sequence length 377
Comment OPHN1 (Homo_sapiens) oligophrenin 1
Sequence
MTYKLHKELVSAAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMT
PSNMGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHFGKICSGPPEESAPPPVPPPR
VAARRHKPITISKRLLRERTIFYTSSVDESEDEIQHQTLNGTITSSLEPPKLPQHLKLPM
SRSGEADPGRKSPSRPVSDGKLDPCPEVDVGKLVSRLQDGGTKATPKTNNGPVPGSGPMK
TPSLHIKRQAPRPLAQHKEGDADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPK
PEIVVGNAGDAPSSVVASRTRFFETASRKTGRHAYVHMLIHKFLKADFLEMRVEATGVDF
GKAFIVMKTDNSIAESR
Download sequence
Identical sequences G5BZ19
HGL_H00000347710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]