SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347755 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347755
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-23
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 2 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 3 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 386-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 303-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000895
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347755
Sequence length 470
Comment ZNF140 (Homo_sapiens) zinc finger protein 140
Sequence
MPQGSVTFRDVAIGFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSIFKPVVVSLLEQ
GNEPWLGKGDMSRDLFSVSQSNGEIKDLSPKHITYEDDSSQYLIMKRIVSQHPTCSSMER
NWQFEDGNEVLQGNQGCIRQVVSGKSQEEALTQHISITAVERPYGCQECGKTFSWCFSLV
LHQRTHTGEKPYVCKECGKTFSQISNLVKHQMIHTGKKPHECKDCNKTFSYLSFLIEHRR
THTGEKPYGCTECGKAFSRASNLTRHQRIHMGKKQYVCRKCGKAFSTGSELIHHQITHTG
EKPYECLECGKAFRRSSHLTRHQSMHKTKTPYECHECTKAFCCHSFLIKHQRIHAGENLY
ECDECGKVFTWHASLIQHMKIHTGEKPYTCAECDKAFSRSFSLILHKITHTGEKPCVCKV
CNKSFSWSSNLAKHQRTHNLENPYEYENSFTTHFLLNTSESHSKNPRIFS
Download sequence
Identical sequences G5ANU9
HGL_H00000347755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]