SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347792 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347792
Domain Number 1 Region: 520-816,847-894
Classification Level Classification E-value
Superfamily DNase I-like 2.62e-74
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000000701
Further Details:      
 
Domain Number 2 Region: 886-976
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000321
Family Canonical RBD 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347792
Sequence length 1507
Comment SYNJ2 (Homo_sapiens) synaptojanin 2
Sequence
MWHSGTGQAQGAYAALETEVPVQSFGHPGVHHTFPSPQEAGHPSREQAFVEAPEEKEVIK
GQYGKLTDAYGCLGELRLKSGGASLSFLVLVTGCTSVGRIPDAEIYKITATEFYPLQEEA
REEDRLLALRKILSSGVFYFSWPNDGSRFDLTVRVQKQGDDSSEWGNAFFWNQLLHMPLR
QHQVSCCDWLLKVICGVVAIRTVYASHKQAKACLISRISCERAGARFHTRGVNDDGHVSN
FVETEQTIYMDDGVSSFIQIRGSVPLFWEQPGLQVGSHHLRLHRGLEANAPAFDRHMVFL
KEQYGKQVVVNLLGSRGGEEVLNRAFKKLLWASCHAVDTPMINFDLYQFAKGGKLEKLEN
LLRPHLKLHWDDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLES
LRLNSKPIVERFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSN
FFDGVRQEAIRLLLVGDVYNEESTDKGRMLLDNTALLVTPRILKAMTERQSEFTNFKRIQ
IAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLTGAVNSEDDSSPADMFAVGFEEMVEL
SAGNIVNASTTNRKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAV
DTVKTGMGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYREITHRLSFPA
GRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFHE
GAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGEINLLDNDLDSDT
KVRHTWSPGTLRYYGRAELQASDHRPVLAIVEVEVQEVDICARERVFQEVSSFQGPLDAT
VVVNLQSPTLEEKNEFPEDLRTELMQTLGNYGTIVLVRINQGQMLVTFADSHSALSVLDV
DGMKVKGRAVKIRPKTKDWLKGLREELIRKRDSMAPVSPTANSCLLEENFDFTSLDYESE
GDVLEDDEDYLVDELRQPVVSDSELGGDDPPDAPSFTAVAPASKSPALIKKKQRPTYKDD
ADLVELKQELEAVVDFRHRSPSRSLSVPNRPRPPHPPQRPPPPTGLMVKKSASDVSISSG
THGQYSILQAAKPLPGAPQQPIFLPNSILKPKARTGISKPYNVKQIKTTNAQEAEAAIRC
LLEARGGTPEEAVNATALRDQGSSKPEPSLGPPLLPCRPAPRVPAIKKPMLRRTGKPTSL
EEQSEENPIHFTVGPPETSLETPPPVTPPRVPPVPKPRTFQPRKDVERRPSRGKPGPDEA
PLVAEATMLPAPEVPSLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQGLPASSDGGSCSPG
PQLETDTLFPQVDFLGTSSAPSPETNGPRVMKPGAASLGGDYQDPFWNLLHHPKLLNNAW
LSKSSDPLGPKARSSERAQTDPVQLSTSVAEEQLLSDHGGKAFNHWVTISDKDKRTTLQV
FDPLAKT
Download sequence
Identical sequences G5B2S4
HGL_H00000347792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]