SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347852 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347852
Domain Number 1 Region: 438-511
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-24
Family SH3-domain 0.00076
Further Details:      
 
Domain Number 2 Region: 502-591
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 3 Region: 613-673
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-18
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347852
Sequence length 674
Comment SORBS2 (Homo_sapiens) sorbin and SH3 domain containing 2
Sequence
MEIWTLCYRWYTCTRGTINLCFFVDLILHVIFHQIFSTDSSETYSQHAQSLDGTTGSSIP
LYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDD
DTDMYNTPYTYNAGLYNAPYSAQSHPAAKTQTYRPLSKSHSDNGTDAFKEASSPVPPPHV
PPRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPPPLPATPTPV
PRAAGRKPLSSSPHGEAARSPSPPPRSGVSAARSAPAPSPIRTDRINPDDIDLENEPWYK
FFSELEFGRPPPKKALDYVQDHSSGVSNEASIYQSSIDRSLERPSSSASMASDFRKRRKS
EPAVGPPRGLGDHIARRTSPSRADLPGSSTTLTKSLISSSPSSPSRAKDRESPRSYASTL
TDLGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHY
GRVGIFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLRKGDKII
LLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKKNTKGAEDYPEPPIPHSYSSDRIHSLSS
NKPQHPVSTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT
KFFGTFPGNYVKRL
Download sequence
Identical sequences G5B2V9
HGL_H00000347852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]