SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347929 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347929
Domain Number 1 Region: 639-713
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-20
Family SH3-domain 0.0000318
Further Details:      
 
Domain Number 2 Region: 1741-1814
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-18
Family SH3-domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1600-1683
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 874-1012
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000109
Family Fibronectin type III 0.00074
Further Details:      
 
Weak hits

Sequence:  HGL_H00000347929
Domain Number - Region: 782-894
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0653
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347929
Sequence length 1892
Comment BZRAP1 (Homo_sapiens) benzodiazapine receptor (peripheral) associated protein 1
Sequence
MEQLTTFPPPGDPGAMEPWALPAWQSWTPGQGDEPGDTAPSIADTPTVLHIRELSSQPQE
AQSLGPAVGTDPEGAEARLPSLRQQAGTSGRGSPRLEDEEVQALPKATTNTSFGDRPNLE
LLRTLEELQQHCAILKEENQMLRNSSFPETEEKVRRLKRKNVELSVIAKRLEERARKLQE
TNWRVVSAPVPRPGASLELCRKALARQRARDLSETASALLAKDKQIAALQRECRELQARL
TLVGKEGPQWLHVRDFDRLLRESQREVLRLQRQIALRNQQEPPLRSPGPAISARAGAPAP
VAPGEATPQEDVDSLPVVLGEPEKQQRVQQLESELSKKRKKCENLEQEARKKQRRCEELE
LQLREAQNENARLVEENSRLTGRATEKEQVEWENAELRGQLLGVTQERDSALRKSQGLQS
KLESLEQVLKHMREVAQRRQQLEVEHEQARLSLWEKQEEVLRLQQAQAEAKREHEGAVQL
LEVGSLEARVRELEEQCRSQTECFSLLAQELQAFRLHPGPLDLLTSALGGSALGDHPPAP
CCCSTPQPSREAGPKDFDLPPGSPGRCTPKSSEPAPATLTGVPRRTAKKAESLSNSSRSE
SIHNSPKSCPTPEVDTASEVEELEVDSVSLLPAATEGNLGGPRVQVYLARYSYNPFEGPN
ENPEAELPLTAGEYIYVYGNMDEDGFFEGELMDGQRGLVPSNFVERVSDDDLLTALPLEL
ADLSRSSGPELSFPSGGGGGSSSGGQSSGGHSQPRLEEEDAGEELSLSPPPEGLGEPPAV
PYPRQLVVLKQLAHSVVLAWELPPERVELCGFHICVNGELHQALGPGAPPKAVLENLDLR
AGPLHVSVQALTSKGSSDPLRCCLAVGARAGVVPSQLRVHQLTATSAEITWVPSNSNVAH
AIYLNGEECPPARPTTYWTTFCNLRPGTLYQARVEAQLPPRGAWEPGWERPEQRAATLQF
TTLPAGPPDAPLDVQIEPGPSPGILIISWLPVTIDAAGTSNGVRVTGYAIYADGQKIMEV
ASPTAGSVLVELSQLQLLQVCHEVTVRTMSPHGESADSMPAPIAPALASACSSTRVTCPS
PRPSPEARTPLAPAPPGPGDPSSPLQRPASHGTPGPPGGPPASPTREMPKGVQEDPPPPC
SQEEVEAAVLGVSGERRPSQSTMGERDPGPSAPCWAAQKAEWTAGEAGSMVCSTQGALTQ
RVPEACCGADPGLRARPEREDTAELGVRLVNPLVDHGRNSDLSDIQEEEEEEEEEEEEEL
GSRTRAFQKQVAGNSVRENGAKPQPDPFCETDSDEEILEQILELPLQQFCSKKLFSIPEE
EEEEDEEDNGEQEKPGAGCSSQDPSPLEPVCLGLGCEGRQPPGLGRCPLSPELSRARDHL
VDMPGLVGGSSRRRGGSPEKPPNRRRPLDPREHCSRLFSNGGPQASARPAPSRERSGLPV
IEAAKGGPEASGKGRPGTSRRYPHGRAPESGLASCLSPKCLEISIEYDSEDEQEVDSGGI
SITSSCYPTDGEPWGTAPAGRPRGPLKVNSGPNPYPHLPAWEKGEPERRGRSVPGRAKEP
PSRVSDTGEARGQNSSGRKGPQRRGAWVPRPSTTELAPLRSPPETLAHWDLPVRVFVALF
DYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYRGECGGQTGYIPCNMVAEVAVD
SPTGRQQLFQRGYLSPDVVLEGTGNSPFVYSTTHTAGPPPKPRRSKKAELEGPAQPFAGP
PKVVASAALKAPHPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGSMDDDGFYYGEL
NGQRGLVPSNFLEGPGPEVGSPDREPRTPQAESQDWIGARGPEVPLGWHCTSSPGSLPRT
ELGEPQGTVEKVRGLLSKGKQLLRKLGSGRKE
Download sequence
Identical sequences G5BJT7
HGL_H00000347929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]