SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348081 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348081
Domain Number 1 Region: 590-848
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.36e-64
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 123-196
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.84e-22
Family Mib/herc2 domain 0.00077
Further Details:      
 
Domain Number 3 Region: 268-342
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.8e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 183-263
Classification Level Classification E-value
Superfamily RING/U-box 7.65e-21
Family ZZ domain 0.0077
Further Details:      
 
Domain Number 5 Region: 1061-1142
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000286
Family Matrix metalloproteases, catalytic domain 0.0035
Further Details:      
 
Domain Number 6 Region: 1147-1225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000013
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348081
Sequence length 1228
Comment MIB2 (Homo_sapiens) mindbomb homolog 2 (Drosophila)
Sequence
MCLELGLRQLSDLAGQGSAHGAGLRSHKAVAVSTRLQQVSLESEASRGALRFPEASGPEL
TSLQGAQGSQEPSSVPGAVREQYHPCASKFMSAVFWGAEAGRAAPAGGAAGPSSLPAMDP
DPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTN
YRAGYQGAHDLLLYDNAQIGIRHPNIICDCCKKHGLRGMRWKCRVCFDYDLCTQCYMHNK
HDLTHAFERYETAHSRPVMLGPRQGLPRVPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGR
VVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEALLRPGLPPSPGKPAEL
QRRVSADGQPFQRGNKVKCLLDTEVLRDKATAAGTPGWRSHSLRAPPQFIGQTGTVHRIT
DRGDVRVQFSHEIRWTFHPGALTKHNSFWVGDVVRVIDDLDTVKQLQAGHGEWTDDMAPA
LGRVGKVVKVFGDGSLRVAVGGQQWTFSPSCLVAYRPEEDTNLDVAERARENKSSLSVAL
DKLRAQKSEPEHPGRLVVEAALGNVARALDLLQRHREQARGQAGPGTHRWLSWQVDTRNQ
GRTALQVATYLGQLELVHLLLQAQADVDLLDEEGNTALHYAALGNQPEAARVLLSAGCGA
NALNGTRSTALHVAVQRGFLEVVRVLCERGCDVNLPDAHADTPLHSAISAGAGASGIVKV
LTEVPGINITATNSQGFTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALN
NHQEVAQILIQEGRCDVNARNRKLQSPLHLAVQQGHVGLVPLLVDSGCSVNTEDEEGDTA
LHVALQRHQLLPLVADRAGGDPGPLQLLSRLQALGLPGSTEMTVGAAVACFLALEGADVG
YTNHRGRSPLDLASEARVLKTLQGCAQRFRERQAGSGVGRAAVPRLTRSTPNTVTNLHVA
AVGPEAAECLVCSELAPLVLFSPCQHRTVCEGECRARGAGVLACVWPTRCCTAECARRMK
RCIRCQAAIGKKLRPGGDIQGWDSVVSNGPVPSPLSPLAPRKRRYTLTPGRLRWDHFKLT
HKILSFPRNLLSPRETRRGLAAAFRMWSDVSPFSFREVDPEQPSDLRIEFPFPTVAATPS
PPRTKTRLVSEGRNVTLRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGKARLSIIANA
VNEGTYTCVVRRHQRVLTTYSWRVHVRS
Download sequence
Identical sequences G5ATN9
HGL_H00000348081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]