SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348150 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348150
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000206
Further Details:      
 
Weak hits

Sequence:  HGL_H00000348150
Domain Number - Region: 208-291
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348150
Sequence length 312
Comment HOMER3 (Homo_sapiens) homer homolog 3 (Drosophila)
Sequence
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELSSPALGLMSHQVPPSPLVSANGPGEEKLFRSQSADVPGPTERERLKKMLSEGVL
WVQVAELEAQVAAEPAPAVEKEAPGPPLEKLEALVRTKDQEIQTLKNLTGGPREALDAAE
LEETEQKVQDLEVRNTELEHQLRATERSLEEVRAERERARAEVGRAAQLLDVRLFELSEL
REGLARLAEASP
Download sequence
Identical sequences G5C5B6
HGL_H00000348150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]