SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348384 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348384
Domain Number 1 Region: 250-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 2 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 378-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 315-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 5 Region: 534-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 6 Region: 480-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 7 Region: 951-1160
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.0097
Further Details:      
 
Weak hits

Sequence:  HGL_H00000348384
Domain Number - Region: 78-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0141
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348384
Sequence length 1173
Comment LAMB3 (Homo_sapiens) laminin, beta 3
Sequence
MRPLLLLCLAWPGLLCAQQACSRGACYPPVGDLLLGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDRRFQLQGIM
MEFKGPVPAGMLIERSSDFGKTWRVYQYLAGDCASAFPGVHQGQPQSWLDARCRTLPQKA
NGQLNGGKLQLNLMDLASGIPATQSQKIRELGDITNWRVNFTKLAPVPRRGYVPPSAFFS
VSQLRLQGTCFCHGHASRCAAKPGAAESPSAVQVHEVCVCQHNTAGPHCERCAPFYNNQP
WRPAEDQDAHECQRCDCSGHSETCHFDPAVFAASQGAHGGVCDNCRDHTEGQNCERCQLH
YFRNRRPGAPAGETCIPCECDPDGAVEGAPCDPVTGQCVCKEQVQGQRCDLCKPGFTGLV
HSNPQGCHRCDCSVLGARRDMPCEEETGRCLCLPNVVGPRCDQCAPNHWKLASGRGCEPC
ACDPHTSLSSQCNQFTGQCPCREGFGGLTCNAAAAIRQCPDRTHGDAGTGCRACDCDFRG
TEDPGCDKVSGRCLCRPGFTGRRCDQCQRGHCARYPVCVACHPCFQIHDAALRLQAGRLG
RLRNATSGLRPGPGLQDVELGPRVLNATSKVEQIQALLGQASAPERDVAQMASSVLSIRG
TLQGLQLDLPLEEEVLSLPGDLESLGRSLSDLLVVYQDKRAKFEKLHSADPSGAFWMLTE
AYERSSQAAQQVSDSSSLLRQLRDSRREAERLERQAQGGGGGARGSELAALWTEVASLPD
LTPTVHKLCGGARQAACTPGACPGELCPQENGTTCGSHCRGALPRAGGAFQMAGQVAEQL
RGFSSQLQQTRQMIRVAEEAALRVQSDAQRLETQVSTSRSQMEEDVRRTRLLVQQVRDFL
SDPATDAAAVQEVSEAVLALLLPSDSATVLRKMREIQAIAARLPNVDLVLAQTEQDVARA
RRLQAEAEQARIRAHSVEGQVEDVVGNLRQGSAALQEAQDTMQGTGRSLRLIQDRVAEVQ
QVLGPAEGLVMGMTEQLGGFRARMEELQRQAQRQRAQAAQAQQLAEDASQRALSAQEGFE
KIKQKYAELKERLGQSPTLGERGSRIHSVQMEAEELFGETMEMMDKMRDMESELLRGSQA
IVLRSADLTGLEKRVEQIRDHISGRVLYYATCK
Download sequence
Identical sequences G5BAM1
HGL_H00000348384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]