SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348461-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348461-4
Domain Number 1 Region: 4-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-49
Family G proteins 0.0000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348461-4
Sequence length 192
Comment RAC1 (Homo_sapiens) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Sequence
MQAISCVAVGDGAVGKTCPLISYTTDAFPGEYIPTVCDNSSASVMVDGKPVNLGLWHTAG
QEDYDRLHPLSCLQTDVSLICFSLVSPASFENVHTKWYPEVQHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKPTSITYPQGLAMAKEIGAVKYLECSALTQWGLKTVFDEAIQGVLCLP
PVKKRKRKCLLL
Download sequence
Identical sequences G5C5K6
HGL_H00000348461-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]