SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348471 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348471
Domain Number 1 Region: 262-364
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-19
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348471
Sequence length 366
Comment SH3YL1 (Homo_sapiens) SH3 domain containing, Ysc84-like 1 (S. cerevisiae)
Sequence
MAQRPQHATEPKSCVHAVKEENTPMNVNNPIPSNLKSEAKKAAKILREFTEITSRNGPDK
IIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFEV
GIEVSDLVIILNYDRAVEAFAKGGNLTLGGNFTVAVGPMGRNLEGNVALRSPAAVFTYCR
SRGLFAGISLEGSCLIERKETNRKFYGQDIRAYDILFGDVPRPAQAEDLYEILDSFTEKY
EHEGQRINMRRAAREQQKAKELPPKPALRLQQPSAPLQLDSSSQGNRHEHKLYPELSGYH
ERAGDSGRPVEVTALYSFEGQQPGDLMFQAGDKITVISKTDSHFDWWEGKLRGQTGIFPA
NYVTMN
Download sequence
Identical sequences G5C0X6
HGL_H00000348471 XP_004868357.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]