SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348602 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348602
Domain Number 1 Region: 115-293
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-49
Family BAR domain 0.0000278
Further Details:      
 
Domain Number 2 Region: 666-742
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-16
Family SH3-domain 0.0000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348602
Sequence length 744
Comment AMPH (Homo_sapiens) amphiphysin
Sequence
MVRRLWGKNGTAAGCGGENLLTHGSQEGAQEKDPLKACPVSHLFQPGPPSSILTTYPAMN
SSMDDSIEYGSPVLNLICFGQCIGSKPHFENRKRLTVKPQMAYGIADGAEETAEGTRLQR
ELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSL
LTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQK
VFEEFNVDLQEELPSLWSSRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQH
ADKAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTR
KGPPVPPLPKVTPTKELQQENIISFFEDNFVPEINVTTPSQNEVTEVKKEETLLDLDFDP
FKPEVTPAGSAGMTHSPMSQTLPWDLWTTSTDLVHPASGGSFNGFTQPQDTSFTMQADQS
MICSLAGSERAAPAEPQTEEPPAAATPAVGMELGLETQAEEPVEEAMVAPGPDADVAVGT
LVPAEGVSVEETEEEKAAVPAGEGGGPEEATVETEVTEVSDSDRPQAAAEMEAEAPQEKV
IPSVVIEPASNNEGNGEHEVAVEAETPKGPEDVAPAGPTGKTPELATEPKPGEDAQATPP
AGQASQELPPGFLYKVEALHDFEAANSDELTLQRGDMVLVVPSDSEADQDAGWLVGVKES
DWLQHRDLAAYKGLFPENFTRRLE
Download sequence
Identical sequences G5B6T9
HGL_H00000348602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]