SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348842 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348842
Domain Number 1 Region: 3-370
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-48
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 1497-1570,1622-1767,1825-1893
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-41
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 617-963
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-41
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 893-1204
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.55e-35
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 5 Region: 1345-1652
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-29
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 6 Region: 307-529
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.73e-20
Family Quinoprotein alcohol dehydrogenase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348842
Sequence length 1895
Comment EML6 (Homo_sapiens) echinoderm microtubule associated protein like 6
Sequence
FFSLALHPDKTLIATGQVGKEPYICIWDSYNVQTLSILKDVHTHGVACLAFDSDGQRLAS
VGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNA
LTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLNLIRTIQGAHSAGIFSM
YACEEGFATGGRDGCIRLWDMDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDS
EIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARC
NMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYL
AVGSNDSLVDVYAVAQRYKKIGECNKSISFITHIDWSLDSKYLQTNDGAGERLFYKMPSG
KPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVK
LFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNDVL
ETAPQEGGTDSYSEESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEKNHA
MPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQTGEVVYHIAAVAVVYNRQQHSQRLY
LGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSAD
GKCLVSVGLDDFHSIVFWDWKKGEKIATSRGHKDKVFVVKCNPHHVDKLVTVGIKHIKFW
QQAGGGFTSKRGIFGGVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDILLLKTVKAHD
GPVFAMYALDKGFVTGGKDGIIELWDDMFERCLKTYAIKRAALSTSSKGLLLEDNPSIRA
ITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLR
IWELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKE
MISDIKFSKDAGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVN
SGAKEQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDVTDVNAASLTK
DCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTAL
MIWTREFVGTQESKLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKVYAVSIREMEGTKP
HQQLKEASVEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYL
NDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSI
HIWDAMTKHTLSMLRSFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRG
GHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLSVAF
GANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGG
AVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILID
GHMEGEIWGLATHPCKDIFISAGNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGEMV
AIGMKNGEFVILLVNSLKIWGKKRDRKSAIQDIRISPDNRLLAVGSSEHTVDFYDLTQGT
SLNRIGYCKDIPSFVIQMDFSADSRYIQVSTGAYKRQVHEVPLGKQVTEAMVIEKITWAS
WTSILGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTEKFAKHKRY
FGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCL
Download sequence
Identical sequences G5B8W1
HGL_H00000348842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]