SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349428-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349428-2
Domain Number 1 Region: 167-271
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-24
Family Canonical RBD 0.00000138
Further Details:      
 
Domain Number 2 Region: 35-131
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.99e-21
Family Canonical RBD 0.00000474
Further Details:      
 
Domain Number 3 Region: 347-437
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.37e-19
Family Canonical RBD 0.0000132
Further Details:      
 
Domain Number 4 Region: 460-546
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000591
Family Canonical RBD 0.00000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349428-2
Sequence length 548
Comment PTBP1 (Homo_sapiens) polypyrimidine tract binding protein 1
Sequence
QRGSDELFSTCVTNGPFIMSSNSASTANGNDSKKFKGDSRSAGVPSRVIHIRKLPSDVTE
GEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSN
HKELKTDSSPNQAVRAHAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENL
FYPVTLDVLHQIFSKFGTVLKIITFTKNSQFQALLQYADPVSAQHAKLSLDGQNIYNACC
TLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGAPGIISASPYAGA
GFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIGIPGLGGAGNSVLLVSNLN
PERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSRAQLAMSHLDGHKLHGKPIR
ITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSI
SISEEDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLR
VSFSKSTI
Download sequence
Identical sequences G5C5X1
HGL_H00000349428-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]