SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349437 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349437
Domain Number 1 Region: 85-234
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-42
Family Mannose 6-phosphate receptor domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 238-381
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.03e-41
Family Mannose 6-phosphate receptor domain 0.000000348
Further Details:      
 
Domain Number 3 Region: 541-676
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-39
Family Mannose 6-phosphate receptor domain 0.00036
Further Details:      
 
Domain Number 4 Region: 1429-1560
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.5e-36
Family Mannose 6-phosphate receptor domain 0.000000203
Further Details:      
 
Domain Number 5 Region: 1280-1420
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-35
Family Mannose 6-phosphate receptor domain 0.00072
Further Details:      
 
Domain Number 6 Region: 673-838
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-34
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 7 Region: 981-1132
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-33
Family Mannose 6-phosphate receptor domain 0.00084
Further Details:      
 
Domain Number 8 Region: 1137-1276
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-32
Family Mannose 6-phosphate receptor domain 0.00014
Further Details:      
 
Domain Number 9 Region: 385-532
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.75e-31
Family Mannose 6-phosphate receptor domain 0.00097
Further Details:      
 
Domain Number 10 Region: 1565-1710
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-30
Family Mannose 6-phosphate receptor domain 0.00082
Further Details:      
 
Domain Number 11 Region: 1900-2039
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-30
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 12 Region: 2046-2193
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.03e-29
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1717-1810,1859-1902
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.02e-22
Family Mannose 6-phosphate receptor domain 0.003
Further Details:      
 
Domain Number 14 Region: 847-991
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-20
Family Mannose 6-phosphate receptor domain 0.0041
Further Details:      
 
Domain Number 15 Region: 3-82
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.76e-18
Family Mannose 6-phosphate receptor domain 0.0000133
Further Details:      
 
Domain Number 16 Region: 1809-1857
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000799
Family Fibronectin type II module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349437
Sequence length 2407
Comment IGF2R (Homo_sapiens) insulin-like growth factor 2 receptor
Sequence
MHDLKKNSFQSVGDSFFRSATRSLLEFNTTTNCQQQNTEHKIQSSITFLCGKTLGTPEFV
TATECVHYFEWRTTAACKKDIFKANKEVPCYVFDAELKKHDLNPLIKISGGYLVDDSDPD
TSLFINVCRDIDSLRDLSPQLHACPVGTAACLLQGNQAYDVGQPKEGLKLASKDRLVLTY
VKEGAGKPDFCDGHSPAVTITFVCPSERREGTIPKLTAKSNCRYEVEWITEYACHRDYLE
SSTCALSSGQHDIAIDLRPLTQPGGSYASDGKEYTFYLNVCGEAKTRSCNKKEAAVCQVK
KIDSTQVKIAGRPKNQTLRYSDGDLTLIYFGGEECSSGFQRMSVINFECNQTAGNDGKGE
PVFTGEVDCTYFFTWDTKYACVKEKEDLLCGASDGKKRYDLSTLARHSESEQNWEAVDGS
QTAAEKKHFFINVCHRVLREGKAISCPEDAAVCAVDKTGSKSLGKFISSPTKEKGNIQLS
YSDGDNCGDDKKITTTITLICKPGDLESAPMLRTSGDSGCFYEFEWHTAAACVLSKTEGD
NCTVFDSQAGFSFDLSPLTKKNGAYKVETEKYEFYINVCGSVSVHTCPLDSGACQISKSN
KKYWNLGLSNGKLSYYDGMIQLSYKDGTPYNNEKHTLRSTLITFLCDRDAGVGLPEYQEE
DNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDLSSLAKSEGGRGGNWYAMDNSGEHIT
WKKYYINVCRPLNPMPGCDRYASACQMKYENDQGTFTETVAISSLGVAKTGPVVEESGSL
LLEYVNGSACTTSDGRLTTYSTRLHLVCSRGSMNTHPIFSLNWDCVVSFLWNTEAACPIQ
TMTDTDQACSIRDPNSGFVFNLSPLNSSQGYVVSGIGKTFVFNVCGTMPACGTVAGKPAS
GCEATSETQELKNLQLEKPVGFEKSLQLSTEGLLTLTYKGFPPEDRGTAFIIRFICNDDV
YPRTTKFLHQDIDSVRGIRNTYFEFETALACVPSPVDCQVTDPAGNEYDLSALSTIREPW
TAVDTTADGKKRTFYLSVCNPLPYIPGCHGSAVGSCLVSEDNSWNLGVVQISPQAAANGS
LSIVYVNGDKCGNQRFSTRITFECAQTSGSPTFQLLDDCEYVFVWRTVEACPVVRAEGDN
CQVKDPRHGTLYDLRPLALSDTIVSVNEYTYYFRVCGQLSSDVCLTQDQSKIVSSCQKKL
GPPKFEKVAGLLTQKLTYENGLLKMNYTGGDTCHQVYQRSTTIFFYCDRSTQKPVFLRET
SDCSYLFEWRTQHACPPFNVTECSFKDGAGNSFDLSPLSRYSDNWEAVTRTGATEHYLIN
VCKSLAPQAGSEVCPPESAVCLLDGSKPMNLGRVGDGPHRIDGVTVLTYVDGDLCPDKVR
RKSTTIRFSCSESQVNSRPLFISAVEDCEYTFSWPTAAACPVQRGVHDDCQVTNPSTGHL
FDLSSLSGRAGFTAAYSENGLVYMSICGENENCAPGMGACFGQTRISVGKASKKLSYVDQ
VLQLVYEDGFPCPSKSGLRYKSVISFVCRPEAGPTSRPVLISLDKQTCTLFFSWHTPLAC
EQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEVDTSDTNPDFYINICQPLNPMHGVPC
PAGAAVCKVPVNGPPIDIGRVTGPPKLNPGGTEIYLTLESSTPCLADSHFNYTSIITFHC
KRGVSMGTPKLIRTSECDFVFEWQTPVVCPDEVKMEGCALTDDQLLYSFNLTSLSKSTFK
VTRDSHTYSVGVCTAAAGLDQGGCKDGGVCLLSGSKGVSFGRLASMQLDYRHQDEAVILS
YVNGDICPSETEEGDTCVFPFILNRKSYDDCVLDGRAKLWCSKTANYDRDHEWGFCRQSN
SHRTSTITFKCDEDEDIGRPEVFSEVRGCEVAFEWRTKVVCPPKKMECKFIQNHKTYDLR
LLSSLTGSWSFVHEGASYFINLCQRIYKGPLDCSERASICKKSASGQVQVLGLVHTQKLD
VLDDRVIVTYSKGYPCGENKTASSVIELTCAKTVGRPSFKRFDIDSCTYYFHWDSRAACA
VRPQEVQMVNGTLTNPVNGKSFSLGDIYFKLFSASGDMRTNGDSYLYEIQLSSITSSSNP
ACFGANICQMKLNGEHFIRKVGTSDRTKYYIQDGDLDVVFASSSKCGKDKTKSVSSTIFF
HCDPLVKEGIPEFSHETADCQYLFSWYTSAVCPLGVGFDRERTKEDIQSHKGLSERSQAV
GAILSLLLVALTGCLLALLLHKKERREIVINKLTNCCRRSSNVSYKYSKVNKEEEADENE
TEWLMEEIQMPPPRLVKEGQENGHITTKSMKAEALTSLHGDDQDSEDEVLTIPEVKVHAG
RGARVDSSHPVRNPQRKALQERKDDRARLVPGEKTWKGKPRSGQHKMVTSTKLVSFHDDS
DEDLLHI
Download sequence
Identical sequences G5BC57
HGL_H00000349437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]