SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349588 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349588
Domain Number 1 Region: 405-793
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.96e-131
Family Ankyrin repeat 0.000000000355
Further Details:      
 
Domain Number 2 Region: 167-424
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-72
Family Ankyrin repeat 0.00000615
Further Details:      
 
Domain Number 3 Region: 8-246
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.66e-59
Family Ankyrin repeat 0.00000942
Further Details:      
 
Domain Number 4 Region: 3524-3612
Classification Level Classification E-value
Superfamily DEATH domain 1.03e-24
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349588
Sequence length 3902
Comment ANK2 (Homo_sapiens) ankyrin 2, neuronal
Sequence
QSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG
SAVDSATKKGNTALHIASLAGQAEVVKILVKEGANINAQSQNGFTPLYMAAQENHIDVVK
YLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKS
AALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI
TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLA
RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK
RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV
LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL
GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPL
HVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAK
NGYTPLHIAAKKNQMHIASTLLSYGAETNIVTRQGVTPLHLASQEGHMDMVTLLLDKGAN
IHMSTKSGLTSLHLAAQEDKVSVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFL
LKQGANVNAKTKNGYTPLHQAAQQGHTHIINILLQHGAKPNATTANGNTALAIAKRLGYI
SVVDTLKVVTEEVTTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDL
KELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHTSYLRDSAMVDDAIV
IPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHN
GLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLP
TAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKE
HFCEYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPE
GGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMPSELVKKILGNKATFSPIVTLEPRRR
KFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNE
CVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCF
CMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFK
ENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEE
EIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSD
KAGSLKVKELVKVAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDKGSQQRSQAEREV
EEEEWVLVSEEDVAEAKEEAPLEILEFPCVEVRLEKETKVKAEKDSAGLVNFLAEDLNAY
VAPQEEKAGEAGEAPAASRSSGKAGKIAPQEEKLSTQKQHRPSLGIKKPVRKKLKEKQKQ
KEEVLTGSEEKTELKKGSSEESLNEDPGLAPAPLPTAKATSPLIEETPIGSIKDKVKALQ
KRVEDEQKGRSKLPIRVKGKEDMPKKATPRTHPVVSPLLRSDRHAPASPSSKTERHSSLS
STAKTERHPPVSPSGKTEKHSPVSPSSKTGRHSPVLIASKPEKHSPVSPSTKTERHSPVS
STKSERHLPVSSSVKTDKRPPISPSGRTEKHPPLSPGRTEKRLPVSPSGRAEKHPLTGKN
DKYLPVSPTGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAK
QKQTQEKGKTRVEKEKGQIASQREMQRTESQTIRRGQRFIVTGLAESRRGVRAPSIGFRK
EEAVGEKEKTPSHKTPEPAQSVYEEESHGEREIPKEKVADEQEDMDLQISPDRKTSTDFS
DVIKQELEDNDKYQQFCLSEETEKAQVHLDQVLTSPFSTAFPLDYMKDEFLPVLSLQSSA
LADSSESLKQEGIAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQ
IGEIKETTKLETPPEIHSEKEPPTTKDIIDGSEDQGVAVPEGPEPSAEAFQKDASPDSPR
DICPKQKDDCSGSPIVPLAEETSRTLAEKVCSDGGQLTLASSAFRTQTDSETQESTATPD
VAKPSTLPDASVKTDPETKPKPHAAIRSPQALELALPSRDSEALSPAADESLAVSHRDSL
EASPVLEDDSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGILSNHFALPATVAKTE
LITEVASMRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKASEA
CTPKPAVIQECTEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYRKEPKQ
EESSSSSDPEADCSADVDELKQMKSVEGKSDVPMLVTSESRKASSSSESEPELTQLKKGA
DSGLLPEPVIQVQPPSPLPSSIDSNSSPEEAHFQPIVSKQYTFKMSEDTQEELGNSEEGK
ASESHSAEDSHPFSTDEADKSYNDLNKDTNQLKICDGHGCEAMSPSSSASPVSSGFQKSA
DDVNEQLVNHKESLASQDTHENDTEGEELDISGVESPQVSCPSESPSSLSSFTHCPVSEE
KELDGDISSTTKIEETNSDPTLESSPKDCFIQDSCIITQTNRLSMDIPESHLVETNEIYD
PHITSPYENVPSQPFFSSEEGKTQIDASHTMSFHSSEVHSVTITSSVAEVVVTSSSSRTV
SSKESNFESENLQAESKPESTVWGMQSDSSFSSPQPTIANTPTIIGEQISKVIITKTDVD
SDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPF
LFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIDQESREETFSEDMKAGTTGAEPQLETT
AESLAPSESKEMADDEAELLPDDLSEDIEEIPTSDTHLDAQVGISASCETSTLEATATGA
EDLPMQMPDTPSPSSRKQVPCLDSPEPVVQVQLDFSTVTRSVYSDRDEQSPDSSPEEVKS
VIEIPTAPMENVSSTESKSRILGRTIPTSSVTHPSVEDECAFSEDFPSSLDEESKEDDAK
PKFKIPIKAPIQRVEEQLPLLDSSLHKIGAPQGRDVTSRAPDNRSKSESDASPLDSKTKW
PGKARSYIETEAESRERAEELESESEEGDTRPKIFVSRLPVKSRSTTSSSKGAVSPTKES
KEHFFDLYRNSIEFFEEISDEASKLVDRLTLSEREQELASDDESSSALEVSVIENLPSVE
TEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQEQIEERLAYVADHLGFS
WTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTSLIECLTKINRM
DIVHLMETSTEPLQERLSHSYAEIEQTITLDHSEGFSVLQEELCTTQHKQREEQAVSQED
GAGDHPPIVSEEDISVGYPTSQDYVPQTEGNSSAVALSPQMHREQVQQDFSGKIQDLPDV
QPXXLVTTPGTEKTEVQKAAAVPDSPSKTPKEVRTLPGEERLDLQSPVSSEWGGSPIVQE
PKEPPEPRGEGSPGKTSLVILEDQPHTFERLDGEAAFEKGEDMPEIPPESVTEEEYIDEH
GHTVVKKVTRKIIRRYVSSDGTEKEEITMQGTPQQPVNIEGGDGYSKVIKRVVLKSDAEQ
SE
Download sequence
Identical sequences HGL_H00000349588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]