SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349708 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349708
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.7e-16
Family TRASH domain 0.0056
Further Details:      
 
Domain Number 2 Region: 895-1295
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000326
Family Hermes transposase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349708
Sequence length 1322
Comment ZMYM6 (Homo_sapiens) zinc finger, MYM-type 6
Sequence
MKEPLDGKCGKAMAPQQKLLDKIKEEPDNAAEYAHAQQPKPQGSELKISAVFSVNQSPLA
QQLTPGFQLSLPSSAPNILFPSVPAIAIQVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITGFSSPVCLQPPPKKTCTNCSKDILNPKDVITTQFENSSASKDFCSQSCLSSYELKKKP
VVTIYTNSISTKCSMCQKNADTRFEVMYENGVHGLCSDACFSKFHSTNNLTMNCCENCGS
YCYSSCGPSQSQKVFSSTSFMAYKQNSAQMPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVTSSGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFNKP
KGTNSSAALPPQGQVIVSTPSRSAVSAGGGGTSSSSSVSGAAPAGLQTLAEQSQQVALAH
TLVKLKCQQCNQMFATKPELLFYKGKMFLFCCKTCSDEYKKKNKVMAMCDYCKLQKIIKE
TVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRLEGKLEEFCCE
ECMSKFTVLFYQMAKCDGCNRQGKLSESIKWRGNIKHFCNLFCVLKFCHQQSMNDLLSQN
KVSISKAQTAMMALPSTRTNTTPVITNVVSLAKIPAAQPTGITKTVSKGAASKEAVKIIE
DKTAQSDAMKCLSSQSSQLPKLLKNKGILCKPVTQTKAISCKPHTQHKECQTDLPMLNEK
SDAEFNSPPAKKKRIGFFHTYDAEYLKVGFIICPGSKESSPRPQCVICGEILPSENMKPA
NLSHHLKTKHSELEDKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQIAASK
KPFSIAEELIKPYLVEMCSEVLGSSAGDKMQTIPLSNNTIGYRIDELSADIEDQLIHKVR
ESKWFALQIDESSEFSAVTLLLCYIRFIDYDCSDIKEELLFCIEMSSQITGFKIFELINK
YIDSKSLNWKYCVGLCTDGAASMTDRCSGLRAKVQEVAMNSVAFTHCFIHREHLAAEKLS
LCLHEILLQSAQILNFVKSNALNSRMLTILCDEMGSEHVNLPLRAEVRWISRGRILTRLF
ELRHEMEIFLNQKHSDLAKYFHDEEWIAKLAYLADIFSLINELNSSLQGTMTTCFSLCDK
IDVFKKKLKMWLKRTQENDYDMFPSFSEFSNSSDLNVKNLRSIIFEHLKGLSQMFHDCHP
PEDDLRSGNLWVINPFMNHQNNNLTDFEEEKLTQLSSDLGLQSVFKSMSITQFWINAKTS
YPELHEKAVKVLLPFSTVYLCDATFSALTESKQRNLLVSGPALRLAVTSLIPRIEKLVKE
KE
Download sequence
Identical sequences G5BJM7
HGL_H00000349708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]