SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349929-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000349929-2
Domain Number - Region: 171-278
Classification Level Classification E-value
Superfamily Tropomyosin 0.0141
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349929-2
Sequence length 344
Comment SDCCAG3 (Homo_sapiens) serologically defined colon cancer antigen 3
Sequence
MLIISDDKPEDLEDANPFSFKEFLKTKNLSLSKDDMSNTRVYPKEASRRSLVLDPGSPTG
QAMGFSLDYQQPFFEDLTGAGDLLDEDEDKEDGWNGAYLPSAVEQTHSSRATTSTSPCGT
YLSFSTASELAGPESLLLWTASDTDSRVSPASPSGSPDMDFEARGESLGDRQLQTLQISY
EALKDENSKLRRKLNEVQSFSETQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNL
ELMTKRAVKAENHVMKLKQEVSLLQAQVSNFKRENEALRSGQGASLTVVKQNTDLALQNL
RMVVSSAHTSIKQLVSGAETLNLVAEILKSIDRISEIKDEEENS
Download sequence
Identical sequences G5B6B3
HGL_H00000349929-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]