SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350170 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350170
Domain Number 1 Region: 205-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000876
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 273-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000215
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  HGL_H00000350170
Domain Number - Region: 47-105
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0522
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350170
Sequence length 666
Comment FXR1 (Homo_sapiens) fragile X mental retardation, autosomal homolog 1
Sequence
MFCFLQGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRA
NEQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTV
DVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRS
IRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVT
AIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKS
GVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQI
DEQLRQIGMGFRPSSTRGPEKEKGCATDESTVSSVQGSRSYSGRGRGRRGPNYTSGYGTN
SELSNPSETESERKDELSDWSLAGEDDRESRHQRDSRRRPGGRGRSVSGGRGRGGPRGGK
SSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDTVLMDGMT
ESDTASVNENGLDDSEKKPQRRNRSRRRRFRGQAEDRQPVTVADYISRAESQSRQRNLPR
ETLAKNKKEMVKDVIEEHGPSEKAINGPTSASGDEIPKLQRTPGEEKINTLKEENTQEAA
VLNGVS
Download sequence
Identical sequences G5C6J8
HGL_H00000350170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]