SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350297 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350297
Domain Number 1 Region: 562-711
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-66
Family Ankyrin repeat 0.00000144
Further Details:      
 
Domain Number 2 Region: 50-280,324-349
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-62
Family BAR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 440-557
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000053
Further Details:      
 
Domain Number 4 Region: 315-434
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 1058-1132
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350297
Sequence length 1134
Comment ASAP1 (Homo_sapiens) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
Sequence
MFTRRSLSCGWNPVTEGSGMELKLLVDERAMMLVGGCAIRTLELQQKLEAHKALDQDRTA
LQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELST
LLKNLLQSLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQ
HGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNF
FQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEVGGLYVP
SRANSDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCAVKNGILTISH
ATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEA
LNMAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDVCCDCGSSEPTWLSTNLGILTCIECS
GIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNEIMEANLPSPSPKPTPSSDMTV
RKEFITAKYVDHRFSRKTCSSSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLESGQ
ELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSMGNTVLHYCSVYSKPECMKLLLR
GKPTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESD
DDLDDKPSPVKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQMFIST
TTDSPTSPTAEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTL
SDPPSPLPHGPPNKGAVPWGNDVGPSSSSKNANKFEGLSQQSSTSSAKTALGPRVLPKLP
QKVALRKTETSHHLSLDKANVPSEIFQKSSQLTELPQKPPPGDLPPKPTELAPKPQIGDL
PPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAADISPKALQPS
EAMQKSHPVDLSPNMQSRDAIQKQVSEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTI
YDCQADNDDELTFIEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences G5B4Q7
HGL_H00000350297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]