SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350331-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350331-2
Domain Number 1 Region: 8-197
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-55
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 208-251
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000536
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350331-2
Sequence length 252
Comment ASB13 (Homo_sapiens) ankyrin repeat and SOCS box-containing 13
Sequence
AQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQAQCVQLLLAAGAQVDARNIDGS
TPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAH
DCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGG
NIYARDNRGKKPSDYTWSSSAPAKCFEHYEKTPLTLSQLCRVSLRKATGVRGLEKIAKLN
IPPRLIDYLSYN
Download sequence
Identical sequences G5BPJ6
HGL_H00000350331-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]