SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350351 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000350351
Domain Number - Region: 178-404
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350351
Sequence length 786
Comment CCDC147 (Homo_sapiens) coiled-coil domain containing 147
Sequence
MCMTRSSTAIVGWSKKYLICGEEKVQKLVLEETAFEEIEKDFQEVLSELSGDKSLERFRI
EYEKLHAIMKKSYDNEKRLMAKCRELNAEIVVNSVKVATALKLSQDDQTTIASLKKEIEK
AWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSLNQDSNIRDLLKFKEEVTKE
RDQLLSEVVKLRESLAQTTEQQQGTERAKEEAEQAISQFQQEIQHHQNEASRESRKKEKL
EKELKQIQMDMDTRQTEIKALQQNVQKSKEELQQLEQQLKEQKILNERAAKELEQFQMRN
SKLQQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMHLDIGKLNKIRERIHKKLHQIE
DQKAEVEQHKETLKNQILGLEREVETSKKQAELDKKAMDELLRERDILNKNMLKAINATQ
KQVDLVKLHEQTKRNLEEEIQNYKEEAQKQRKIIFQLEKERDRYINEASDFTQKLLMNME
GIKVREMQIFHYKKKIAESETKLKHQQNLYEAVRSDRNLCSKNLVEAQDEITEMKRKLKI
MTRQVDQLKEEISAKESTLVKLSLEQQRIEKEKETLKAELQKLRQQALETKRFIAKQEAE
ERKLLRIIAEADGERLREKKELDQVTSERDILGSQLVRRNDELALLYEKIKIQQSVLNKG
ESQYNQRLEDMRILKLEIKKLRREKGILTKSVANVEELRQELFHMQKEFLKERTRCRALE
EELENPMNVHRWRKLEASDPSSFELIQKIHALQRRLISKTEEVVEKELLLQVVFPPQSWP
PTSPGP
Download sequence
Identical sequences G5C8J5
HGL_H00000350351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]