SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350377 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350377
Domain Number 1 Region: 496-614
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-30
Family PLC-like (P variant) 0.00000256
Further Details:      
 
Domain Number 2 Region: 190-313
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.14e-29
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 344-460
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-19
Family PLC-like (P variant) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350377
Sequence length 870
Comment MCTP2 (Homo_sapiens) multiple C2 domains, transmembrane 2
Sequence
MDLDKPSVWGSLKQRTRPLLINLSKKKVKKNANKPLDLRAGHHLDRGLSLSVPDLLEAEA
LVPEGHPYSGPHSSYTSVPSSLSTAGIVPKSSSSSLKQSEEELDWSQEETRNLHAVETDS
EEIYASPTEESWVSSQGLLDLHRPPLGGDAPEEPEKLPGNGDLNASMTSQHFEEQSALGE
AGDGLSNLPSPFAYLLTIHLKEGRNLVVRDRCGTSDPYVKFKLNGKTLYKSKVIYKNLNP
VWDEIVVLPIRSLDQKLRVKVYDRDLTTSDFMGSAFVILSDLELNRTTEHILKLEDPNSL
EDDMGVIVLNLNLIVKQGDFKRHSSLIRNLRLSESLKKNQLWNGIISIILLEGKNISGGN
MTEMFVQLKLGDQRYKSKTLCKSANPQWQEQFDFHYFSDRMGILDIEVWGKDGKKHEERL
GTCKVDIAALPLKQANCLELPLESCLGALLLLITLRPCVGVSVSDLCVCPLADPMERKQI
SERYCLRNSLKDMKDVGILQVKVLKAVDLLAADFSGKSDPFCLLELGNDRLQTHTIYKNL
NPEWNKVFTFPIKDIHDILEVTVFDEDGDKPPDFLGKVAIPLLSIRDGELNCYVLKNKDL
EQAFKGVIYLEMDLIYNPVKASIRTFTPREKRFVEDSRKLSKKILSRDIDRVRRLSVAIW
NTIQFLKSCFQWESTLRSTIAFVVFLVTVWNFELYMIPLALLLLFFYNFIRPMKGKASIT
QDSQESTDMEEEEDDEDDKESEKRGLIERIYMVQDIVSTVQNILEEIASFGERIKNTFNW
TVPFLSVLACLVLAMATIILYVIPLRYIILIWGINKFTKKLRNPYSIDNNELLDFLSRVP
SDVQKVQYSELKLCSSHSPLRKKRTTLGPH
Download sequence
Identical sequences G5ATA0
HGL_H00000350377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]