SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350649-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350649-2
Domain Number 1 Region: 25-118
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000606
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 137-204
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000262
Family Synaptotagmin-like (S variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350649-2
Sequence length 215
Comment CPNE4 (Homo_sapiens) copine IV
Sequence
MASVCFLLLPALAQFHQLCSKKALVALLSVHFAAHVDRTEVIRTCINPVYSKLFTVDFYF
EEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKQGNTAGKSSITV
IAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSP
AWKSFKVSVNSLCSGDPDRRLKLLLIGKEEIPFKF
Download sequence
Identical sequences G5BKK3
HGL_H00000350649-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]