SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350686 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350686
Domain Number 1 Region: 5-52
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000883
Family LEM domain 0.0032
Further Details:      
 
Domain Number 2 Region: 283-394
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000421
Family Ankyrin repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  HGL_H00000350686
Domain Number - Region: 146-181
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0152
Family N-terminal domain of RNase HI 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350686
Sequence length 868
Comment ANKLE2 (Homo_sapiens) ankyrin repeat and LEM domain containing 2
Sequence
METVLARLKLLNPDDLREEIVRAGLKCGPITATTRFVFEKKLAQALLEQGGALPASLPNH
VGPDTPSMLITAAGTRASCSEDRDFGYNVGLNPPEEEAVMSQTCPVPLSASAGIGTQKAG
ETVTKAPALYYGVCPVYDDGPTRNERIHVYADKKEALQAVKMIKGSRFKAFPTREDAEKF
ARGICDYFPSPNRASSPLSPGKVAPLFSSGGWKDGLCLSESETINKEGANSYKSPRTQDL
TAKLRKAVEQGEEKAFSDLVWSNPRYLIGSGDTPTIVQEGCRYNVMHVAAKANQASICQL
TLETLENPEFMQLMYPDDDMGMLQERIQYLVDLYLNTPDKVGYDTPLHFACKFGNVEVVN
VLSSHPLIEKKTRNKYNKTPEEVICERNKNKPVELKERIREYLQGHYYVPLLRADNTSSP
VIGELWSSAQTAEALPAGRCGANPRDPVQTVRAFAGPLSPAKAEDFRKLWKTPPREKAGF
FHSVRKSDPERGIERVGRELAHELKIPWAEYWEFLDCFVDLSSQEGLQRLEEHLAQQEMD
KKAQQETGENEACRREKAFASGHEQQCCNSVSVGAFLDGHGDVSLEEMKDRQNAAQNHSQ
PAADASRNLEPKAKADCTAASGLCRTDPNGLCCPSPSQALCGRPEAPGTEQALLSRVSSL
MIEFDKLNLQNEVSGLSKTPNTDKKTKDKRKNTVENDLLAPAPAADKPGNNQTGVENDMS
GVLATMSLDSKSQAVPGPVTNPTTRLFLCGGDPCKLDQDVLAALQGADVDPHRYPAVYQW
RNAVLCYSPTDRRSWPSPALKGKLKCQLPDLGCPHSGSPGRSGRDGSSPGRPGHGPHSPG
LGSPGRYSPAHGRLLRRTAIPSTELTAL
Download sequence
Identical sequences G5ANV6
HGL_H00000350686 XP_012927330.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]