SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350820 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350820
Domain Number 1 Region: 352-484
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.46e-32
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.064
Further Details:      
 
Domain Number 2 Region: 188-347
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.14e-28
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.043
Further Details:      
 
Weak hits

Sequence:  HGL_H00000350820
Domain Number - Region: 82-129
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00129
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350820
Sequence length 544
Comment MTPAP (Homo_sapiens) mitochondrial poly(A) polymerase
Sequence
MATRGVWLLTRLPLCSQTRSPVQCPALRRLSCAGTVAAGLRREEQPSGSVETGCQDKTPT
KTFYEEQDERREQAQRTVLVHCPSKISEKEFLKHLSQHGPVHSHFFYESFGLYAVVEFCQ
KDSVDSLLNVTQIPAMGMEAVIPFRSRFLNLKLKSPSRPVSEMSPIQPSNQLPPSNRKLS
ELLYSAESVNDQLSTLLKELQLTEENTRLRYLICSLIEDIATAYFPGCTIRPFGSSVNTF
GKLGCDLDMFIDLHEIRKLRTHKRIGNFLMEFQVKNVPSERIATQKILTVIGESLDHFGP
GCVGIQKILNARCPLVRFSHQASGFQCDLTTNNRVALKSSELLYIYGSMDSRVRALVFSI
RCWARAHSLTSNIPGSWITNFSLTMMVIFFLQRRSPPILPTLDTLKALAELLLKEFFEYF
GNFAFNKNSINIRQGREQNKPDSSPLHIENPFETSLNISKNVNQSQLQRFVELARESAWV
LHQEDAYLPSSSSKPPWGLAALLLPSVMQSTKKQKKRCGSERIKSLLESMKSGSPESSAN
TSRN
Download sequence
Identical sequences G5C5F2
HGL_H00000350820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]