SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000350882 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000350882
Domain Number 1 Region: 751-897
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-36
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 1835-1990
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 531-684
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-34
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 5 Region: 103-251
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-34
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 6 Region: 1405-1557
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-33
Family Spectrin repeat 0.0000209
Further Details:      
 
Domain Number 7 Region: 1297-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-32
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 309-462
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-31
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 10 Region: 1643-1777
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-29
Family Spectrin repeat 0.00000181
Further Details:      
 
Domain Number 11 Region: 1940-2095
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-28
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 12 Region: 2102-2215
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 2319-2456
Classification Level Classification E-value
Superfamily EF-hand 5.88e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 14 Region: 1563-1673
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-20
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 15 Region: 976-1038
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 16 Region: 899-970
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 17 Region: 1067-1174
Classification Level Classification E-value
Superfamily Spectrin repeat 5.36e-19
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 2217-2326
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.00094
Further Details:      
 
Weak hits

Sequence:  HGL_H00000350882
Domain Number - Region: 1218-1242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000350882
Sequence length 2482
Comment SPTAN1 (Homo_sapiens) spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMGSDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPMSASQIHMKREELIANWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQVLLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQERPGRDPEDFVFFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFA
TKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVN
EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA
ARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDL
TNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALK
EPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQ
AEIAGHEPRIKAVTQKGNAMVEEGHFASEDVKAKLNELNQKWEALKAKASQRRQDLEDSL
QAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALR
EQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
DRQGFVPAAYVKKLDPAQSASRENLLEEQGSITLRQEQIDNQTRITKEAGSVSLRMKQVE
ELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWIHEKEAALTSEEVGADLEQVEVLQ
KKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGVMPRDEGDSKTTS
PWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIE
EKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGDTAQRLIQSHPEAAEDL
KEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKD
VTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERADL
EKAWVQRRMMLDQCLELQLFHRDCEQAESWMAAREAFLDTEDKGDSLDSVEALIKKHEDF
DKAINVQEEKIAALQAFADQLIVAGHYAKGDIATRRNEVLDRWRRLKAQMIEKRSKLGES
QTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQTVLVFQSKHQKHQAFEAELHANAD
RIRGVIDMGNSLIDRGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFN
TGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLDADISAHEDRLKDLNSQADSL
MTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLSESHRLHQFFRDMDDEESWIKEKK
LLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGRKLSDDNTIGQEEIQQR
LAQFVEHWQELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAA
IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKA
AAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAG
LQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQS
HFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQ
ADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEEND
KLRQEFAQHANAFHQWIQETRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGA
AMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSM
MFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQE
YMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVD
GKGRELPSAFDYVEFTRSLFVN
Download sequence
Identical sequences G5ASE4
HGL_H00000350882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]