SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351108 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351108
Domain Number 1 Region: 77-192
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-28
Family Canonical RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-25
Family Canonical RBD 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351108
Sequence length 261
Comment HNRNPAB (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A/B
Sequence
KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ
KEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGDFGEIEAIELPMDPK
LNKRRGFVFITFKEEDPVKKVLEKKFHTISGSKCEIKVAQPKEVYQQQQYGSGGRGNRNR
GNRGSSGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQ
GSTNYGKSQRRGGHQNNYKPY
Download sequence
Identical sequences G5BCC6
HGL_H00000351108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]