SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351416 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351416
Domain Number 1 Region: 1012-1342
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-83
Family Ankyrin repeat 0.00000743
Further Details:      
 
Domain Number 2 Region: 169-493
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-77
Family Ankyrin repeat 0.0000256
Further Details:      
 
Domain Number 3 Region: 430-651
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.61e-58
Family Ankyrin repeat 0.0000756
Further Details:      
 
Domain Number 4 Region: 1661-1732
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351416
Sequence length 2538
Comment ANKRD17 (Homo_sapiens) ankyrin repeat domain 17
Sequence
MLSGAAACMAVELCPHRERADGSSRQSCKERGNKAQAASELAGGHGQDVKFMGAELAGTN
AALVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLEAAGIGKLS
TADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAEACSEGDVN
AVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAA
ANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGH
TPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQE
HKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIE
RGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLE
VADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENG
HTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVL
SLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLSAPP
PDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPASIATTLPIRNKAASKQKSSSHL
PANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHADQLTKEKI
EELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQQQQQSCQH
LGLLTPVGVGEHLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQALPLAAGP
LPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLNDTLDDIMA
AVSGRASAMSNTPTHSIAASISQPQTPTPSPVISPSAMLPIYPAIDIDAQTESNHDTALT
LACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDSGADIEAQSER
TKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAE
INSRQTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEV
VSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIA
ADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVDAADNRKI
TPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQAKDR
QAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLEEIEAKNK
ENFELQAAQEKEKLKVEEEPEVLTEPPSATTTTTIGISATWTTLAGSHSKRNNTITTTSS
KRKNRKNKITTENVQIIFDDPLPISYSQPEKASGECKSSSTSESGDSDNMRISSCSDESS
NSNSNSSLKSDSHQPAVATATVTSKKQPSVLVTLPKEERKSVSGKASIKLSETISEGTSN
SLSTCTKSGPSPLSSPNGKLTVASPKRAQKREEGWKEVVRRSKKVSVPSTVISRVIGRGG
CNINAIREFTGAHIDIDKQKDKTGDRIITIRQGGTESTRQATQLINALIKDPDKEIDELI
PKNRLKSSSANSKIGSSAPVTTAANSSLMGIKMTTVALSSASQTATALTVPAISSTSTHK
TIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPAQSTW
GPFPVRPLSPARATNSPKPHMVPRHSNQNSSGPQVNSAGSLTSSPTATTSSSASVVPGTS
TNASPSSPSVRRQLFVTVVKTSNSTTTTVTTTASNNSTAPTNTTYPMPTAKEHYPVSSPS
SPSPPAQPGGVSRNSPLDCGSVSPNKGASSSEQEAGSPPVIETVNSRPPNSSSSSGSSSV
HSTQKQPPGSVSQEPRPPLQQSQVPPLEVRMTVPPLATSSAPAAVPSTAPVTYPMPQTQI
GCSQPPKMETSTIRPPSHGTSAPLKNSAPVQNSSVAILNVNHIKRPHSVPSSVQLPSTLS
TQSACQNSVHPANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVVSSQSTPESMLS
GKSSYLPNSDPLHQSDTSKAPGFRSPLQRPTPSPSGIVNMDSPYGSVTPSSTHLGNFASN
LSGGQMYGPVAPLGGAPAAANFNRQHFSPLSLLTTCSSASSDSAAQSVSSGVRAPSPAPP
SVPLGSEKPSAISQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIWSFEGI
SGSQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDNTGIVTPSGTFHQHVPAGYMDF
PKVGGMPFSVYGNAMIPPVAPIPDGTGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTV
WTGPWAPHMNSVHMNQLG
Download sequence
Identical sequences G5B5P4
HGL_H00000351416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]