SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351644 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351644
Domain Number 1 Region: 17-78,203-274
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-25
Family TrmE connector domain 0.0051
Further Details:      
 
Domain Number 2 Region: 74-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-23
Family G proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351644
Sequence length 274
Comment GTPBP3 (Homo_sapiens) GTP binding protein 3 (mitochondrial)
Sequence
MPGWTRGAAGGGECSPRRSHAQALAYVEAYIDFSEDDSLEEGVLEQADREVRALEVALVS
HLQDARRGQRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLA
GFPALLSDTAGLREGVGPVEQEDPSGSSPRLLLVLNKSDLLPAEGPHPQPGPHPHLLLSC
LTGAGLDGLLGVLKKELAVVCGDPSTGPPLLTRARHHHHLQRCLDSLGHYKGAADLALAA
EALRTARRHLTQLTGGGGSKEILDVIFQDFCVGK
Download sequence
Identical sequences G5B7V7
HGL_H00000351644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]