SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351697 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351697
Domain Number 1 Region: 2586-3000
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.17e-112
Family DNA polymerase I 0.0000298
Further Details:      
 
Domain Number 2 Region: 31-67,98-174,2284-2321,2362-2546
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.28e-69
Family DnaQ-like 3'-5' exonuclease 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351697
Sequence length 3119
Comment REV3L (Homo_sapiens) REV3-like, catalytic subunit of DNA polymerase zeta (yeast)
Sequence
MFSVRIVTVDYYMASPLQGLDICQSPLTQVPVKKVPVVRVFGATPAGQKTCLHLHGIFPY
LYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
KFRKARRKSDTLTATGSPKDRLSGHSLAGTFFRWEEDEIPSCLILEDVEPQSTCELEVDA
VAADILNRLDIESQIGGNPGLQAIWEDEKQRRRNRNESSQFSQPESQDHRFVPATESEKK
FQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSDILSPEMLQCTPANMIEVHKD
TELSKDDTTHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSLDEGLVHLLAG
LESDGFQGERNRMPSPCHSFGDTKIPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEH
CAKKGSLCRNTHRSSTEDDDSSSEEEMEWNDNNLLLANLSIPQLDGTADENGDNPLNNEN
SRTHSSVIATSKLSVKSSIFHKDAATLEPPSSAKITFQCKHTSALSSHVLNKEDLIEDHS
QPNNIEKGLDSSVASFTNESTYSMKSLNCTVHSENSHKESSKKDILPVSSCQSSIFDYGE
DIPSVTRQVPSRKYTNIRKIEKDVPFIHMNHHTIENTLGKNCFSFSNLSHSKNKLPSDGN
EKGNSTALNSLFPSSLTENCELLSCSGENKTMVHSLDCIADESGLNKLKIRYEEFQEHKT
EKPSLSQQAAHYMFFPSVVLSNCLSRPQKLSPVTYKLQPGNKPSQLKLNKKKFIDHQETS
TKSSEAGSTKDSCIQNNPYNPEKDNVLAGGIIKAPRGAFENRTPTDSFLDCHFGDGTLET
EQPFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRK
MSKKLPPVIIKYIIINRFRGRKNMLVKVGKIDSKEKQVILTEEKMELYKKLAPLKDFWPK
VPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTSSENIKRTLSFRKKRSHAILS
LPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPKAEEIMAAAEKE
AMLFMGPNSYSSKTVTSRVGKSNRTRVQVKKSKAKHVNPSVVTKKRNKRNQTNKLIDDGT
KKPRAKQKQKTNEKCKSRKHITFKDEKIKSQSGAEVKLVLKQQNVSELTNSSGGSQVLFK
QKEVLLTDSATDHPLSVPQPIGISAQQKLSSCFSSFLESKKSDLQTFPTSRDDLHSSVAC
SSIGSGISKINIQRSHNQSAMFTLQESTLIQKNVFDLSNHLSQVAQSTQISSGMMSPKTE
ESANLQKNYLSSIGKLNEYRSSLESKPDQVCAPNFLHCKDSQQQLVCMAEQSKHSETCSS
GNAASEESQMPNNCFLTSLRSPIRQIAWEQKQRGFILDMSNFKPERVKQRSLSEAISQTK
SLSQCKNQTVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANIMQDSLSNKQQPNKIISSS
LEHKANKRTRSVTSPRKPRIPRSTKPKEKTPKLLKTDSLNLQNSGQLDSSLSDDSPVFFS
DPGFESCYSFEDSLSPEHNYSFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDL
LPGQILEKSEFLSHDNQECEDKHNASDSTSWIRSSPELFEKSPIDSNENHCHHQWKNSFH
SLTTRSKSIMDSFCVQQAEDCLNEKSRLSRSSVSKEVFLSLSQPSSSNWIQDHTRKEMGQ
SLDSVNTSFTTILSSPDGELVDAASEDLELYVSRNNMLTPTPDSSPGSASSPLQSKNGIF
APRTAHILKPLMSPPSREEIVATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVE
TRLPNDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPIRNGQGVVNKGLSNSHKMVEDK
KIVIMPCKCAPSRQLVQAWLQAKEEYERSKKLPKTEPTGILKAVEDLSPLANPNDKPVVP
PQMDESPRILPTIAHTKKAVNNSHIALQVPTTGCSQTASRSQMLLSFASANDPKKGEGDD
DNCYISYSSPDSPVIPPWQQVASPDSKALNRDNKPSSPIEKLCSLGVENFLKPIRGGIQK
SPSSETGESPVISPTRARTRKCESLCLHSTPIIQRKLKERFPEATGLSPLSTEPKTQKLN
NKKGSNTDTLRRVLLTTQAKNQFAAVNTPKKETSQIDGPSLNNTYGFKVSIQNLQEAKAL
HEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKD
KTVSGQDIRYQTPLLIRSGITGLEVTYAADEKALFQEITNIIKRYDPDILLGYEIQMHSW
GYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINIVGRITLNLWRIMR
NEVALTNYTFENVSFHILHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQML
EQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSIQQRSQMRA
PQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYEEFKFGCT
SLRVPPDLLYQIRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSVKAYKQDK
ALSRMLNARQLGLKLIANVTFGYTAANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTK
KWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQT
KKRYVGYMYESLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQ
RQCMKLLEGKASIQDFIFAKEYRGSSSYKPGACVPALELTRKMLTYDRRSEPRVGERVPY
VIIYGTPGVPLIQLVRRPAELLQDPTLRLNAIYYITKQILPPLARIFSLIGIDVFSWYHE
LPRIQKATNSLRGELEGRKGTISQYFTTLHCPVCDDLTQHGICNKCRSQPQHVAVILNQE
IRELEHKQEQLVKICKNCTGSFDRHIPCVSLNCPVLFKLTRVNRDLSKAPYLRQLLDQF
Download sequence
Identical sequences G5AUP0
HGL_H00000351697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]