SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351881 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351881
Domain Number 1 Region: 46-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-30
Family Ankyrin repeat 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351881
Sequence length 261
Comment ANKRD46 (Homo_sapiens) ankyrin repeat domain 46
Sequence
MAVLRRGPRTTRTPPSSAALCSAFAPSTSHIGEMSYVFVNDSSQTNVPLLQACIDGDFNY
SKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGH
VDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKL
ETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSL
GIAYYVSGVLPFVENQPELVH
Download sequence
Identical sequences G5ANZ8
HGL_H00000351881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]